AVPR V2 (AVPR2) Rabbit Polyclonal Antibody TA342645 from OriGene Technologies | Biocompare.com

Supplier Images

AVPR V2 (AVPR2) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
AVPR V2 (AVPR2) Rabbit Polyclonal Antibody

The AVPR V2 (AVPR2) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to AVPR2. This antibody recognizes Human antigen. The AVPR V2 (AVPR2) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-AVPR2 Antibody

Product Specs
ItemAVPR V2 (AVPR2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA342645
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetAVPR2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-AVPR2 antibody: synthetic peptide directed towards the C terminal of human AVPR2. Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS
NCBI Full Gene Namearginine vasopressin receptor 2
NCBI Gene AliasesDIR3, ADHR, V2R, NDI, NDI1, DI1, DIR
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!